PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_197040_ozas.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family EIL
Protein Properties Length: 611aa    MW: 68176 Da    PI: 5.1421
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_197040_ozas.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3436.13.2e-133383721330
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel++rmwkd+++lkr+ker++ +  ++  a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++
  Bv8_197040_ozas.t1  38 EELERRMWKDRIKLKRIKEREQLE--AQR-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNI 125
                         8******************99964..455.599********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ng aai+ky+a++l+++++ ++   + + +++l++lqD+tlgSLLs+lmqhcdppqr+fplekgv+pPWWP+G+e+ww+
  Bv8_197040_ozas.t1 126 RAWWKEKVKFDKNGLAAIAKYEAECLVMTEGANN--GNGNGQSTLQDLQDATLGSLLSSLMQHCDPPQRKFPLEKGVPPPWWPSGDEDWWS 214
                         *****************************88888..6899*************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX........ CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss........ 265
                         +lgl+k q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++l vl++ee+++++ s+++         
  Bv8_197040_ozas.t1 215 KLGLPKGQN-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRLVRQSKCLQDKMTAKESSIWLGVLGREESLIRQPSSDNGmsgvtgsp 304
                         *********.9**********************************************************************4444677776 PP

                         .XXXXXXXXXXXXXXXXXXXX.....XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......X CS
                EIN3 266 .slrkqspkvtlsceqkedve.....gkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcq 330
                            r +++k  +s+++++dv+     + ++ + k+ q++++t g+p ++ r    ++++ + ++  s+  +
  Bv8_197040_ozas.t1 305 hGPRGEKRKPAASSDSDYDVDegagsVSSKDERKNQQSDEETIGAPETNTRS-SIRNKNLIGKQ--SKRKK 372
                         655669999999*********9998844444446777788888888888887.44444444444..22333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.0E-12538285No hitNo description
Gene3DG3DSA:1.10.3180.108.5E-72161293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.09E-61166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MGELEDIGPD YGSDIEVDDL RGGNIAEKDV SDEEIEPEEL ERRMWKDRIK LKRIKEREQL  60
EAQRAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGL AAIAKYEAEC LVMTEGANNG NGNGQSTLQD LQDATLGSLL  180
SSLMQHCDPP QRKFPLEKGV PPPWWPSGDE DWWSKLGLPK GQNPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP DIAKIRRLVR QSKCLQDKMT AKESSIWLGV LGREESLIRQ PSSDNGMSGV  300
TGSPHGPRGE KRKPAASSDS DYDVDEGAGS VSSKDERKNQ QSDEETIGAP ETNTRSSIRN  360
KNLIGKQSKR KKSQGKPSSI DEQTSPSKDD QLLVAAPNDK QAAPSTIENL VEPVGPVSDM  420
DHENEDLNGF LMHDSSNQED NGSLFIEPLV PMATDNLGQY HPLASDYGQY GYLSNVRPPN  480
IMSRQNMLAA DQSFHHAMVQ ENELQHADSY YDPSIQYGQR HDKQYGQGHD VQNLQHPISE  540
PQARNEIVGM HLPSLNLTGN EITGSHLPVF DGPFNSSLGS PFHDLSLEFS LGDYEIEDFG  600
LDEDFLEYTG A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-721652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688276.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_010688277.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-180EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0J8BTC00.0A0A0J8BTC0_BETVU; Uncharacterized protein
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-168ETHYLENE-INSENSITIVE3-like 3